dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C0Z0P7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C0Z0P7|C0Z0P7_LACRE) Penicillin-binding protein, transpeptidase domain protein {ECO:0000313|EMBL:EEI08558.1} KW=Complete proteome OX=585517 OS=Lactobacillus reuteri MM2-3. GN=HMPREF0535_1612 OC=Lactobacillus.
Sequence length 719
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWTMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGQPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQASDEANKELSGKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]