dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C1DTM2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C1DTM2|C1DTM2_SULAA) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=204536 OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825). GN=SULAZ_0467 OC=Sulfurihydrogenibium.
Sequence length 802
Sequence
MKVPYSWVKEFVDIDIPASEVAEKLNLIGIETTVYKFGNYIPNITTVKILSVEKHPEKDK
LFVCKVSDGEREYQVITGADNVKAGSVVILAQPGAVILGKEIKPVKFGSISSEGMLLSLQ
ELGLEEKSDGIFLLDEDTPIGVDANKVLDIGSDDIFEIEITPNRGDVLSVKGLSREIAAA
FGLKRKDYYPQLPSVENSIEINIQTDKVLRYKATVIKGIKVKQSPLSVRLKLIKSGLSVI
NNIVDITNYILLQEGQPLHAFDLDKIEGKITVRNAFEGEKILTLDGQERVLTNQDIVIAD
DKKPLAIAGVIGGENSKIDQNTQNILLESAVFDPTSVRKTAKRLSILTDSSYRFERGVDI
ENCSTASDKAVSLILSLAGGEVKTVKDLYLKPYQPKTVVLRPSFIEKILGSKIEDETTIK
ILTGLEIPVEKEGEEFKVHIPSFRSYDLEREIDLVEEVARVYGYDKFEEDYPKIPTKIFS
KPKDYEFDTKVRQFFLNSGFTEVLNYTFTSPDFYNTLSLPLPKIHIQNYILKSQSVMRDT
VVVSLIQNQVENLRFGRKDLSIFELSSTFFDDHESINVAGLVSGKLVDGYNYTSPIRSFS
TNRDWDFLSLKGVIDNFLTFLGLDYLVSDENLPVFLHPYESANIIVMGYTVGYVGKIHPK
VAAEFEIPKNTFVFELKLKYVPRDINENPLKEGYIYTYYLNKRPIIYKEIPKYPPVKRDL
AFVIDVNLKVGNLIEDLKKASNLVKNIKLFDVYFLSNSRKSVAVSVEFLHPDKNLSDEEV
NLEVEEILNKLKLIYPDIELRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]