dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C1F7U8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C1F7U8|C1F7U8_ACIC5) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_1830 OC=Acidobacterium.
Sequence length 688
Sequence
MRILTQWLRDYVALPSISDAELADALTLRGIAVDGVFDLGAHGSVFEMDVTTNRVDAMNH
YGVAREASIIFGCALKPLDGSLPAPKPGSAFPVRIEEPTLCGRFTARVLRGVTIQPSHGI
VAERFAALEQKLISNAVDATNFVTLGMGHPTHAFDLDKLEGGIVVRRARKGEKLVTLDGV
ERTLDPDDLVVADEKKAVGLAGVMGGLDTAISASTKNILVEAAWFDQNTVRRSSRRHGIH
TDASHRFERGADFNAPPLANALVSRIILEAGGHIEGELVDVLIPEAEARTAKRAAVSFAV
PEIARILGATEDPQGITAADAEGILTGLGCTLEKSGEQSYSVTLPSWRLDLEREIDLLEE
IARVYGYNRFQNTLPTFAGSVVELPWAAKEATLRGKLLGLGWNEAISSTFCAEADALAFC
REPNSAVAVGNPLSEEAGMLRPSLLPGMLTMLANNLSRDVESVALFEIGTVFTGSTEKVD
ERPALAIGATGRPFGAGEVDFYDLKGTLQELLHSFTARSLYFDRFPAESGLMPAWLHPGR
SARAVIDGATVGYFGQLHPAEAERRKVKQTVLVGELYLDRLYKQSLRTPVIEELSRYQAV
RRDFSFLVPDAVSWGQLAEAIVALPIPELRSFAPREILRGERVAAGHYSLLLGTVFQSHE
RTLRDEDLQAWAQQVIAAMQDRGAQLRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]