dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C2SCU6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C2SCU6|C2SCU6_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EEK97398.1} KW=Complete proteome OX=526975 OS=Bacillus cereus BDRD-ST26. GN=bcere0013_54530 OC=Bacillus cereus group.
Sequence length 111
Sequence
MSSSEIIDVLCENLNDGIWALRVLYAEGAMNKEKLWDYINQYHKDYQIENEKDYEGKKIL
PSRYALDIMTARLEGAGLISFKAIGRVRIYDVTDLGNVLIKELEKRVEKNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]