dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C4YIH4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C4YIH4|C4YIH4_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ45909.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_04249 OC=Candida/Lodderomyces clade; Candida.
Sequence length 142
Sequence
MSSDPLTSNARPATDSLITVRIIKSFPYRNVKNYIIKDIDLKSTTPKQLLEKLHEIINTT
GALRPYRNVEYNSIKIYTKAHGSKSMNLVINFDNDEDWVLVNPSNNGDKQSLWDLDIRNE
TELSLFNWDDYVAYKENPVEKW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]