dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C5C335 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C5C335|C5C335_BEUC1) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ACQ81879.1} KW=Complete proteome; Reference proteome OX=471853 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432). GN=Bcav_3637 OC=Beutenbergia.
Sequence length 115
Sequence
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]