dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C5PI97 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C5PI97|C5PI97_COCP7) Zinc knuckle containing protein {ECO:0000313|EMBL:EER24250.1} KW=Complete proteome OX=222929 OS=Coccidioides posadasii (strain C735) (Valley fever fungus). GN=CPC735_056200 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence length 193
Sequence
MPEEAWAILKKASDERDLEDFREALKIYSKAVPLATFDEIEKKFRADNFKIYLIGLSATS
PKIALRKVSTAELVAIAGKEEGHMSKECDKPRNMDNVTCRNCEKTGHMSRDCPEEKDWSK
VQCTNCKEMGHTFRRCNKPAEGADSDNADSYGGFYGAGIGSKNHHDQTRGRKETTAQSAG
NWYEEPTDGGAGW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]