dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C7MGV3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C7MGV3|C7MGV3_BRAFD) 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase {ECO:0000313|EMBL:ACU84294.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_04210 OC=Brachybacterium.
Sequence length 510
Sequence
MPRSAAPDLPATDVLTTDVLVAGAGPTGLMAGLVLARRGVRALVIDPKPGPTRESRAIVV
QPRSMEIFDQLGLADAVLDSAQLTLQLQIRGGQSPVGADFFAQQQGLTPFPGVQIFEQSR
TESLLGTALAADGAPVLHGHRLVSFTAEAGVEALVEGPEGPLRIRSRFLLGADGASSPVR
HQLGLDFAGVTDDATFCVADLHGVEGAPEDAISVRFGRERFALLFPLGPGGHARLIWLHG
ETHPEQETALAGARQDLGIRYEDVAWFSAYRVHHRVASRFRAGPVMLAGDAAHVHSPVGG
QGMNTGLQDAHHLANLLADVLSGRREERELDRYERERRPVALTLIGATDRAFGIIARTGR
GTALLRRRARHVLALLAPRLLATRFGPYAGGLLGQYRIRYHPVDAGEPAPRWARDRAVGR
RLRPTAENRDALRAMDWQLHSYGTDAARPAVPDWIHGPLVFPPDPAGQLRDDRLYLVRPD
GFVAAAFPLHAGAAAVADVDEALAAYAVVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]