dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C7PK35 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C7PK35|C7PK35_CHIPD) DNA repair protein RadA {ECO:0000256|HAMAP-Rule:MF_01498, ECO:0000256|RuleBase:RU003555} KW=Complete proteome; Reference proteome OX=485918 OS=2034). GN=Cpin_0878 OC=Chitinophagaceae; Chitinophaga.
Sequence length 457
Sequence
MKIKTAFFCQNCGYESAKWTGKCPSCGQWNTFVEEKVQKDIPLRNAGWQPEKEHGAKSDN
IVNLSEISGTEEERLLTPDAELNRVLGGGIVPGSLVLVGGEPGIGKSTLFLQNALLLKDI
TTLYISGEESAQQIKMRADRLQVKNDLFYLLTETSTQTIFQEIKKLRPQLVIVDSIQTLQ
SPFIESAPGSVSQIRETTAELQRFAKESHTPVFLIGHITKDGSIAGPKILEHMVDTVLQF
EGDQHYAYRILRTIKNRFGSTAELGIYEMTGGGLRQVTNPSEILISQREDQLSGVAIAAT
IEGMRPMLVEVQALVTQSVYGTPQRTATGFDLRRLQLLLAVLEKRGGFHFGVKDVFLNIA
GGIRVEDPSIDLAVLCALLSSYEDIPISSKICFAGEVGLSGEIRAVNRIEQRVAEAEKLG
FEKIFISRYNKKGTDISKFNIEVIPVGRVDEVYRGLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]