dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D0SHB6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D0SHB6|D0SHB6_ACIJO) Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106} KW=Complete proteome OX=575586 OS=Acinetobacter johnsonii SH046. GN=HMPREF0016_03239 OC=Moraxellaceae; Acinetobacter.
Sequence length 406
Sequence
MPVGDVSMPQMHVVKGVRIGTAEAYVRYQNRRDLVIFEFAEGTNVAGVFTQNAFCAAPVH
VSKAHLHVANPRYLIINTGNANAGTGKTGMLNAERTCAKLAELARVQATEVLPFSTGVIG
EQLPLERLLNGLQPALNSLSADAWDAAATGIMTTDTTPKGASEQFELDGITYTMTGISKG
AGMIRPNMATMLGYVATDAPISRELVQQLLSETVNVSFNRITIDGDTSTNDSCIFAATGQ
AGGVEICSTQDARYTVVLDVLTRMMKRLAQLIVRDGEGATKFITVAVEGGHDTQECCDIA
YSIAHSPLVKTAIFASDPNWGRILAAIGYAGVKNLDVEKIQVWLDDVQICKDGGAAADYT
EAEGARVMSQAEMTIRVDLGRGAAKDTVYTCDLSYDYVKINADYRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]