dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D1AWE8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D1AWE8|D1AWE8_STRM9) B3/4 domain protein {ECO:0000313|EMBL:ACZ00624.1} KW=Complete proteome; Reference proteome OX=519441 OS=NCTC 10651 / 9901). GN=Smon_0131 OC=Streptobacillus.
Sequence length 231
Sequence
MKFIAEESYWNLFPNSKLGIVLIEDMNNGGESSKEIKEALMASNEEAKKYFIKDNFSENP
VISVWREAYQKFKTKKGVRSSIEALLKRVEKGNEVSSINPLVDIYNTISLKYGMPCGAED
SDTFKGILRLGITEGNDEFYLIGEDKNSPTLQGELCYRDDEGAVCRCFNWRDGKRTMVTD
KTKNAFLIIELIDNEREKELNDALNEIAENIEKYLMAKTKIVILSKDNREI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]