dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D2QZT0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D2QZT0|D2QZT0_PIRSD) Limonene-12-epoxide hydrolase {ECO:0000313|EMBL:ADB16563.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_1889 OC=Planctomycetaceae; Pirellula.
Sequence length 156
Sequence
MSDIDLIHRWLKAFQSSDYDTMATCYHPDATFTDIAFVLQGQKQIHAMWHMICENGIEVE
LRESPRASGETVTTKIIDTYKLSNTGRQVKNPVLCTFRFREGKIIEQRDECDPIAWAAQA
FGGIKGWFVGRIGLLRRIAARKKIEAFIQQHPQYAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]