dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D2R6Q2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D2R6Q2|D2R6Q2_PIRSD) Translational regulator CsrA {ECO:0000256|SAAS:SAAS00970184} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2683 OC=Planctomycetaceae; Pirellula.
Sequence length 75
Sequence
MLVLSRKKDERIVINGNIVITVVEVKGDKVRIGIEAPHEVPVHRHEVFEALARAHREIAN
GATKPDLPPVSTTER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]