dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D3Q502 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D3Q502|D3Q502_STANL) Uncharacterized protein {ECO:0000313|EMBL:ADD42182.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_2500 OC=Stackebrandtia.
Sequence length 144
Sequence
MAWIIWLAVAVALGIAELFTLTFVLLMIGAGAAAASLAAALGSPVELQGLVFVVVSVLSL
IGIRPWAKKLRDNRSGPDAKIGLQALEGAEALVLERVDSQHGLIKVQGQEWTARSYDGKQ
VLEQGEEVNIVEIRGATAMVWRQP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]