dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D3ZM82 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D3ZM82|D3ZM82_RAT) Similar to RIKEN cDNA 9930023K05 (Predicted) {ECO:0000313|EMBL:EDL94497.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_57645 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence length 469
Sequence
MEARPPKGPGKQFTFDYENEVHKRDYFIKSPPPQLFFSATSWKKRLFILSQSQGKGLSLS
YYKDHHRRGSIEIDGSATVEVGINSQEKMQSVQKMFKCHPDEVMCIRTVTRDYFLIGRDR
EKIKDWVSFMTPYCRGVKATHQRAEEKPSLGDRRPVSDPSPFLGLCNIPEGISLASPRAS
LPEHLIQKSLQRFRQDHYHHEHDFYSEPTQDAEEEEYYLTPRSLENIDGANDSGDSAESN
SPDQGFKRAESNYVSMRSMRSCLVKEATSAPADCQAEFQISPETSELGPPHQEQDTGSDP
CLLPADSEAQTTDDQQGSASLTVVKLSILLNNITDESQVETLNVFLSPRDVINYLALVEA
AGRICVARWEGPPRLGCLFHHGDHILAVNDLKPQSLEEVSLFLTRCIQKEKVKLSIGRIP
NSEKLHAFPCACSLRHQFAESAQQDLPGRERTPKRSPAIKKNQKEAIGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]