dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D3ZUW2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D3ZUW2|D3ZUW2_RAT) RCG26239 {ECO:0000313|EMBL:EDL79599.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_26239 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence length 617
Sequence
MSENGKEVSSQAAKTESSTQTPSHWESIHSKPRDQLKKRSSRKKAFKILQEKMLKLQCVF
MDHFLQRTSQQMQCLPPGDQQCTRASRKQEKKMGFLLSQIINHIWSNTVKKLKFKVPPLP
CSDSRCGIKAGHQALSSWQTGQPRPRLGDFEDAFADRTLSKRGTGIYEFYHLSFQGYEAY
QTDKYHQDKNPSGYINLSTSENKLCLDLITARLTQCDMNFLDEAQLQYSDWKGEPSLREE
LASFLTHYCKAPTPLDPENVVVLNGCSSVFSSLVMVLCDPGDALLIPTPCYSGFTFSSYL
YSKVELIPVYLESQVTETNKYSFQLTVDKLKLTLTQAKKKGKKVKGLVLINPQNPLGDVY
TQGSLQEYLVFAKKHKLHVIMDEIYMLSVFEPTVTFHSILSIENLPDPNMIHMIWGTSKD
FGMSGIRFGVLYTHNKEVASAMKAFGYHHSVSGIIQYKLRQLLQDKEWINKVYLPKNHSR
LREAYSYVTKMLEDLKIPFCNCGSGLFVWINLKAYLNPCTFDQEQILHQRFQDKKLLLSS
GKSFMCIEPGWFRLVFAEKHPQLQVAMGQFCQVLAEHKKGETTEQQEKPTGTDDVDGCLH
PVAPDSPLSLAQAPPQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]