dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D4P8I2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D4P8I2|D4P8I2_CYPCA) Core histone macro-H2A {ECO:0000256|PIRNR:PIRNR037942} OX=7962 OS=Cyprinus carpio (Common carp). GN= OC=Cyprinidae; Cyprinus.
Sequence length 367
Sequence
MSARGGKKKITKLSRSARAGVIFPVGRMMRYLRTGTHKYRIGMGAPVYMAAVIEYLAAEI
LELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGG
KVKVESQVAVPEKSAKRKPVKKPYKKSKGKPGRKPKKSTENDKEADANAMEDGPGEGFTI
LSAKSLFLGQKLSLTESEISKIGTIKVEGIINPTNAEIDLKEGIGNALEKTGGKDFLETV
KELRKSQGPLEVASVAVSQANGMAARFIIHCHVPQWGSDKCEDQLEKTVKNCLSAAEEKK
LKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSATTSSLKNIYFVLFDSESIGIYLQE
MAKMDAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]