dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D4ZLX1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D4ZLX1|D4ZLX1_SHEVD) Nitrite reductase [NAD(P)H], large subunit {ECO:0000313|EMBL:BAJ02670.1} KW=Complete proteome; Reference proteome OX=637905 OS=DSS12). GN=SVI_2699 OC=Shewanellaceae; Shewanella.
Sequence length 867
Sequence
MERKPRLLVVGNGMVGHHFIEQLCDQGLNEHFQIVVFGSEQVAAYDRVQLSKYFETGSAA
SLMLANVDIYAKQGVTLHLGKEVTGLDTENKCLHTQDGDFWFYDKLVLATGSYPFVPPIE
GKDRPQCMVYRTIEDLEQIQQAAEKSTSGVVIGGGLLGLEAANALLTLGLETHVVEFASQ
LMPVQLNDKAGDLLRHKIEHLGVSVHTSKATTAIVAGESALHRMNFNDDTYLETDMIVFS
AGIRPQDSLARQSGIEVGERGGIVINDFCLTSADDVYAIGECALWQQRIFGLVAPGYQMA
RAAVSHINAGANKADTSSSLVKFEGADMSTKLKLLGVDVASIGESRGFDKAQFVELTDNQ
AGTYKKLWLDESGRYLKGAVLVGDASDYNLLLNQYLSGDELEGPAVDLLQREEGASIVMK
DNAIICSCHQVTKADLVASVQAGSHSLAEVKACTKAASGCGGCSALVQSVITQTMEEQGL
ETEKGICCHFEYDRQELFHLCQVEEIGDFTTLIKAHGKGEAAAVALGCDICKPVAASIFA
TLDNEYVLKVQHANLQDTNDAYLGNLQKDGSYSVVPRIAGGEITPDKLIALGEIAKRHDL
YTKITGGQRIDLFGAQLSELPMIWQELIEQGFETGHAYGKSLRTVKSCVGSTWCRYGVQD
SISLAIDLENRYKGLRAPHKIKFAVSGCTRECAEAQSKDIGVIASDKGWNLFVGGNGGMR
PRHGDLFATDLSTADLVTYIDRILIFYAKTAARLQRTSVWLESLEGGLDYLKSVVIDDCL
GVAAELETQMEKVVSTYQCEWRTSLENPEFLSRFSEFVNPEKMPQVNVDQYRYSRGQRFP
AGSVGTIAVTNLPSDASPNVELVELSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]