dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5CMV8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5CMV8|D5CMV8_SIDLE) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=580332 OS=Sideroxydans lithotrophicus (strain ES-1). GN=Slit_0554 OC=Gallionellaceae; Sideroxydans.
Sequence length 189
Sequence
MGGKIVVVGSSTGGTEALKVFLSAMPEHAPAILIAQHMPELFTRSFAERLDHLCAVHVKE
AGHHEDIVAGHVYLAPGHSHLSLECVAGKYRTVLSRDPPVNRHRPSVEVLFHSAARCLGA
NAIGVMLTGMGKDGAAAMLEMKRAGAYNFAQDEASCVVFGMPREAIALGAVDEVLPLDRI
AERVLARVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]