dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5ED23 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5ED23|D5ED23_AMICL) Elongation factor Tu {ECO:0000256|HAMAP-Rule:MF_00118, ECO:0000256|RuleBase:RU004061} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0311 OC=Aminobacterium.
Sequence length 400
Sequence
MAKEKFERAKPHLNVGTIGHIDHGKTTLTAAITKCLSTKGWSNFEAYDMIDKAPEERERG
ITINISHVEYQTENRHYAHIDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHV
LLARQVNVPAVVVFMNKTDQVDDDELLDLVEMEIRELLSKYDFPGDDVPIIRGSALKVLE
EGTGEENDPVSKCIWELMAACDSYIPAPQRETDKPFLMPIEDVFTITGRGTVVTGRVERG
MIKSGEEVEIVGMKADTTKTVATSLEMFRKILDEAIAGDNVGILLRGIDKEDVERGQVLA
KPGSITPHTKFKAEVYVLKKEEGGRHTPFFAGYKPQFYFRTTDVTGGIKLPEGVEMVMPG
DNATFEVDLIVPIAMEAGLRFAVREGGHTVGAGVVTEILG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]