dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5ED86 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5ED86|D5ED86_AMICL) Asparaginyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00534} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0375 OC=Aminobacterium.
Sequence length 434
Sequence
MSAPWIYIHNLAQHEGESVTIKGWMYNKRSSGKIHFLQLRDGTGTVQGVMVKREVSEEAF
ENAKRLWLEASVEVEGTVRLDERAPSGVELTVTGLKVIQNPDEEYPIGKKDHGIDFLLDN
RHLWLRSSRQQAIMRIRERVIWAAREYLHNEGFMLIDSPILTGSIGEGASGLFELDYFEN
DKAYLAQTGQLYAEAAAAAFGKVYCFGPTFRAEKSKTRRHLTEFWMLEPEVAFYDHDLNI
KLQENLVAYIVEHVLLHCKNELESLGRDLSKLEKVKPPFYRITYDKAIEMLHELGSSTPY
GDDFGNEDETILTQQFDKPIFVECYPKKVKAFYMKEHPENPDLVLCDDLLAPEGYGEIIG
GSQREDDMKRLIARIKEEGLNEKSYDWYLDLRKFGTFVHSGFGMGIERVIAWICGLEHIR
EASPWPRTIYRIKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]