dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5EEE3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5EEE3|D5EEE3_AMICL) Uncharacterized protein {ECO:0000313|EMBL:ADE56925.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0792 OC=Aminobacterium.
Sequence length 166
Sequence
MINKKEEKADSMEITSFSPEQTRLIGECMARHVYSGLTILLYGDLGAGKTVLVKGLGDGL
GARGVRSPSFTLINEYEGRLPLAHVDLYRLERGDEYELGLCEYADDGFVLVIEWPDRLAE
QPTKDLWKLYFCRDSETVRRISFKAEGEKAVKTMELLLKDIGEIGQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]