dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5H5M5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5H5M5|D5H5M5_SALRM) Cobalt-zinc-cadmium resistance protein czcA {ECO:0000313|EMBL:CBH23330.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_00409 OC=Rhodothermaceae; Salinibacter.
Sequence length 1047
Sequence
MNRAIDWFARHGVAANLLTMLLLVGGVVAGGLVVQENFPEFSLDAVEVRVRYPGASPEDV
EDDIVRRVEDRIEGVEGIDRLLGTAADNIGVVTAELKRGTNLDRARTDIKSEVDRVTSFP
ENAEEPVVTEVTNREQVLQVALHGEASLRALKNAAQRAEGDLTRTPQVSYAEVSGVPDEE
ISIEVSRGALRAHGLTLAQVSRIVREGSLDLPAGSIETEDSDITIRTEGQNYTKSDFEDI
VLLSRNDGTNVLLGDVATVVDGFEQNSDLRTRFDGDPAVLLNVFRTGDEQALSVEEAVKT
YLSETLRPTLPRGIEATVWRNSAESLRTRLTIMVENGVLGLVLVLVVLTLFLAPRKAFWT
ASGILLSFVGALIFMQQFGVSINMLSVFGFIIAMGIAVDDAIVVVENVYAEQERTGAPLT
AAVEGTQRVATPVVFAVLTTIAAFAPLLFVGGTIGKFLGDIPTVVIFVLIVSVVEVLFVL
PAHLSHGTGDDGPSTAVGQWLDGIRAGVHDRLVAFVHGPLTTLLRFATRRYGVTLVGGLS
LLVVTFSLVANGYVKNEFFPSIPGNVVTAQLEMPPGTNADETARRAERLRAQGLGVLRDL
EKEADERLLENTYTTVSRQPVASGGRTQAGFTAPRPNVAEVSIEMVDAEARSVPSPVLEE
QWRDTVGTPAGVQSLAFTSTAGGPGGDPVSVQLFAPTVDAMTRAADVVQDTLRRYAGVQD
VTVDWEEKRELSLRMKPAARSLGLTLSDVARQVRAAFFGTESFRLQRGEDEVRVYVRLPA
AQRSAVADLSDYRIRAPGGAEVPLEEVATVSLGYSPTQIDRQDGRRVVTVSADVNPAVTT
GGATTARLERATLPALQAQVPTLSYQFGGQQREQRKAQGSLQIGFLLALFAIYGLLAIPF
RSYVQPLIIMSTIPFAWIGALFGHFLLGYNLILPSIFGIIGLSGVIVNDALVMLDFANEE
RGEGATWRDALVRAGQVRFRPILLTSLTTFFGLAPFILERSVEAQFLVPMAISLGGGILV
GTAVLMLIVPALAMLQRDVVAGLRSLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]