dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5H8T4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5H8T4|D5H8T4_SALRM) Probable cytidine deaminase {ECO:0000313|EMBL:CBH24439.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01518 OC=Rhodothermaceae; Salinibacter.
Sequence length 237
Sequence
MRHGPWQERRFECVDGPVKKVLPGAACKRRLGQAHERPRAPRRPGTKRRDSRMMEAIWAG
APVPLPGSRFRFLSIESDPPMPSPSSFLREAIEMAVQNVTTGQGGPFAALVVRDGEIVGR
GTNVVTTLNDPTAHAEVTAIRRACDALDDFELAGCTLYATCEPCPMCLGAAYWARLDRVY
YAATQEDAAEAGFDDHHIYEEMAKPPTERQIPMDQALSEEANRPFEAWLDYEDRVAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]