dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5HBR0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5HBR0|D5HBR0_SALRM) Spermidine N(1)-acetyltransferase {ECO:0000313|EMBL:CBH25465.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_02544 OC=Rhodothermaceae; Salinibacter.
Sequence length 169
Sequence
MESSPRVSIRKATPDDAKTLVDLIVELATYENLLDEAEPSVELLEEHLSAEALTGCEALL
AETERDTAVGFALFFHNYSTFQTNAGLYVEDLFVRSTYRGEGIGLALFRRLAEIAEKRGC
RRIDWAVLDWNTEAIEFYDELGAEPLDDWTTMRLDEEAIEEIATAGAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]