dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5U7S1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5U7S1|D5U7S1_BRAM5) Putative pre-16S rRNA nuclease {ECO:0000256|HAMAP-Rule:MF_00651, ECO:0000256|SAAS:SAAS00701333} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_2800 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence length 141
Sequence
MVLGVDFGRKKTGTAFMDMNIKIPFPLLLIEESNAKKVKRALMDIIEEKNIDTVVFGLPL
SDEGKESEWCSEIRRFSDFLLKSVKVNVVFVDEYGTSKEADYILRGRKKNVKKKANDLIA
AALILENYLNVLNMNNKNDNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]