dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D5U9H9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D5U9H9|D5U9H9_BRAM5) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ADG71352.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_1259 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence length 110
Sequence
MVRTIIEDKTAIINIEKNIISENVDILEEKLNYVKNAGALNFIFDFHNIEYMCSSALGLI
ASALRVSGENGGSVYFCSLSKKLKALFESTKFLTIVNTANNVDEALNNIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]