dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D6WPU0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D6WPU0|D6WPU0_TRICA) Uncharacterized protein {ECO:0000313|EMBL:EFA06873.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC009818 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence length 1322
Sequence
MHPSRRRKKRPNYGIRTVEVLRGSNGFGFTISGQQPCILSCIVANSPADHAGLRAGDFLI
SVNGISVSKITHDAVVNLIGNCVGPIRMTIAENYYSDSSEEELDVSRMMGARKPKYMHKP
RPHRCYKQSPSENTKKHNENIKYNDENSGNLLNISNQMSMEDEAGPVEYKALVGYLGTIE
MPKQLLPNSRLQTVCSCIKKLRQEKRAPTAVLMTIFPTCLTLKNSSNHILAIYPTNRVVY
IGSTADRESRYFGLVTSAVSDMRSTENLKHFQWSEDKKFNNTEPEIEISNSCHVFMIDPK
IVDHSVHAKKADTFKFSCTTDVITGGCLEFPRNALYIVNLVQTMYKLQNNESPKNDEASL
GPLVANSPQPSASSNSDSGIGFRDDCGNISDRILVVEFPTHRPFPIVNATNNRPSGIDAS
SIPLESLDLPLNNEINNKNHDIKSKQLNNLNNIRACGSVNIKNVLGKNDNHFLTKQNNDG
EVYNRLTCRAMPDRPMRVTRGLSPTSSDDNTKVPDSKSSETLSVSEDVDFQSSVDNISTH
SSKSDLKGVFKAPSMFFFENKKLKRQSKMVNSCDNLDKFEENIMNYKLSPKVYGLSKPNH
SCEELNNFDTVEKYGYGSLQELCRWDGQGKMRNIAQSEPDVRMQRNGMECEKNGPKESEG
PAGWASSFEKLLDDPLGLHTFAEFLKKEFSAENIYFWTACERYRRLPAGPARVAEAQRIY
QQHLCVGAPEGVNVDSHGRHCTEQALQEASEALFDQAQKQIFNLMKFDSYPRFLKSSLYK
QSLAGELERPQIDSGLLLQPPTPTKLKKSLSNAEDRRRKSLLPWHRKNRSKSKDRGESEY
CQKRGDIVTSCESVNGKLGGGSDTHSSKSSLTSLDLAITSTQDLSKGSQDETSSTVARGP
LCRVVLSNGSTTVVQIKTTESIQQLVTRLLDKRGIVYSAFEVYTNKHQKALDVTDPSTKL
AGCEVTIEQRVTFKLDLPNKKVISVKSKHTKIIADVLRPILQKYNYNLDQAKVTIGDTEA
VDIHLPVTSIDEKRLRITYCEKTVPATPVIKVNNVKAKLDEITNQVFEDILQEKADSAFL
KAKSDKGSVKSEDWGSEHSSGIFGRFLRRDSGLHDRKKKSLMKLKPPGNSSDDVTGEQVK
KPLIAKWKTGVNKLQVACSESDELVEGLTRAQRSRLEDQRGTEINFELPDFLKDKNSRFF
VENGDLRRNNYENRNIMPKDFNNLTNNNNNNSFTNHNQKLNNLRIYSPNKFSSDESSPSK
SLENTVIENKKDSSKCEPPPLPPKPKIVPIKPPNWGQNGYYKKELGASDKKMYLEQPSSS
FV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]