dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D6YS46 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D6YS46|D6YS46_WADCW) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_1542 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence length 797
Sequence
MKLPLSWILEVIDLNLPSHKIANMLTMAGLEVDGCTPLPLAFENVVVGEVLRTERHPDAE
KLCIATVFDGEEQFQVVCGAPNCRPGLKTAFAKIGSVLRDEEGKAFKIKKTKLRGVESYG
MLCSEDELGIGDHGSGIMEFADRIQVGADISEIYGDTVLEISLTPNLGHCASVLGVVREL
AAMTGKQYRLPAIKIEENEEEAFEAVSVEVACFEKCPRYACRVIKGVKVGPSPDWLQKKL
LACDQRPVNNVVDATNYVLMEMGHPLHAFDYDLLEERRIVVRTAQEGEAFVSLDEKRRVL
TSDDLLICDGKKPVAIAGVMGGLNSEVHEGTVNILLESAYFEAAGIRRTSKRLALQTEAS
RRFEREADPNQVLAALDRAAVLIKEISGGEICRGVVDVKQKDFSPKEVKCRLSRVNAVLG
TQLGMSEVNDLFTRLEFGVKWDGKDTFTLTIPTYRADINSEVDLIEEVARIYGFDNIPKP
SSYFTSSDMPHAPIFVFEREIRRRLMAEGLQELLTCDLIGPKLQEAVNGPIMPPENIVKV
LNPVSVEQSILRTSLLPGLLQVAKHNYDHECRNLSGFEIGRIHFKEEGRFKEQSMAGVLL
MGNRHPDHWERKKDGADFFDLKGIVESLLLETGVLDYQFRSGNLHFFHPGRQGSLCIGEQ
EVGILGEIHPTILRRMDLSNKVYYAEIDLHLLYQMRQSRRLMEPMPVYPASDRDLTVTVE
ENVAIQEILEVISSVKSRLLENVSLIDIYRGEKVGESKKNVTLRFIYRNVKKTVSQEAVD
AEHARITSQIEARIRRY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]