dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7B820 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7B820|D7B820_NOCDD) Peptidase S1 and S6 chymotrypsin/Hap {ECO:0000313|EMBL:ADH70328.1} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_4945 OC=Nocardiopsis.
Sequence length 514
Sequence
MRSRTLLPALVLAVTATVVTAVPAHAIVGGNPSTQSYEFMGSFQPDYPAPPRPDGHGCGV
VVLAPQWVLTASHCAGKNPTNARTGVPRGWSVRVGSPDSDSGGEVAEVDHYYRLATSGDE
GGFWGRDLALMHLERPVEAQPLPIASASPPPGTPVRIMGWGMTCDDAGNPDCFPTRLREA
DTVVQPPSACLGQAVEGELCVGSRDGSVAAANMDSGGPALVREDGAWALAGVVSGPSGEG
APTLFTDATRHTGWIDGVVSGTDVPPDDEIPDVEGMVDLQGCVGSVVRTPASEPDAPALM
LTNGHCVREDWPAPGEALVDRPADLEVPVADPRGYPRVTARAERLVYATMTGTDVALYRL
DRTYEQLASQGAKTFELGTTPVRPGDEVTMVSPGTRSDCSVEAVPAHLREGGYQQDDPIR
YASGEGCLPYPGMSGSVLLAPDGSTVVGVHNTHNRDGEECTDDNPCEVDADGNVTFERGR
GYGQQVHTVPACLTDRSELDLSRRGCSLTGAGSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]