dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7D9G5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7D9G5|D7D9G5_STAHD) GHMP kinase {ECO:0000313|EMBL:ADI32411.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_1318 OC=Desulfurococcaceae; Staphylothermus.
Sequence length 424
Sequence
MADKDPTRYIVSEYKRFYGLEPEVIVSAPGRLDFLNTHQDYKGLPVVSIGINLRTYVAIS
RSPSNYSRIISLNMLWEDKGFQDIFRVENTFLRMDKWFGNYIRASMIALKQCCGSIGDVW
ALIYSDIPIGAGLASSAALLVAFIGGVNELYGLGLDRRDVAELAYHVEHDIMNIPCGRLD
QYGSAYGGIVRIETKPPYNVEELQRINGVFVVLDSGIKHSTADIHPLRQAEINTGLRLLL
QMNDLDRRVREKLAREYYAVKWDMIRYEEIKPYLYRLPVIPRKRIEFTFKMNDSTRLALE
VLKGGIPSFEKWVTVLGWGWRDKILEAMKNSDPVLSLIGLTMNYQHILLRDLYDVSLPQI
EKIRDAALSAGGLGAKISGAGLGGSLIVLAKDRGTAEKILRKALDNGAVRGWIVEIDSGL
RREA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]