dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7DZI1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7DZI1|D7DZI1_NOSA0) Pentapeptide repeat protein {ECO:0000313|EMBL:ADI62933.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_0362 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence length 163
Sequence
MMYSRQGLALLLTVIICWVASPVLADWTHPLSFSNAELGRQDFSGQSLQAAEFSNANLEM
ANFAGADLRGTVFSASVMTKANLHGANLTNAMVNEVKLNGADLSDAILLEALLLRSIFTD
VNIEGADFSDAILDRSQIQELCKKASGVNSQTGVETRESLGCR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]