dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D8J276 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D8J276|D8J276_HERSS) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=757424 OS=Herbaspirillum seropedicae (strain SmR1). GN=Hsero_3378 OC=Oxalobacteraceae; Herbaspirillum.
Sequence length 211
Sequence
MSELPLPELAARPIEAIVIGASAGGVEALSEILPALRRGAAVATMVVLHLPRERPSLLAQ
IFADRCRQPVVEAQDKEPAQAGVIHFAPPDYHLLVDRSEDGPILAMSNDELVNYSRPAID
VLFESAADVYGPRLLGILLTGGNHDGAAGMQAIARAGGVTVVQSPQQAQVPYMPAQALAM
GNIDYVLTLQQIADLLRTLGASGLAQEKERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]