dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D9SFQ8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D9SFQ8|D9SFQ8_GALCS) Spermine synthase {ECO:0000313|EMBL:ADL55355.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_1329 OC=Gallionellaceae; Gallionella.
Sequence length 228
Sequence
MIPFKLVDTAFEAGVALRLYQRGDEFSIRVDKAGELMNSRAHHSEEVLAEVACRMIANRQ
KPHLLVGGLGMGFTLAAVLSHTVPEARVTVAELIPAVVRWNREFIGQLAGAPLADARVHV
MELDVGQVMRQGKNSFDAIMLDVDNGPSSFTHEDNDALYSLRGLKLIYDALKPGGVFTVW
SASTDPAFTQRMIKTGFNVSEQRVGSHASKRGNRHNIWIGVRPDHFSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]