dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E1GWW4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E1GWW4|E1GWW4_9BACT) 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:EFN90823.1} KW=Complete proteome OX=679191 OS=Prevotella amnii CRIS 21A-A. GN=HMPREF9018_0684 OC=Prevotella.
Sequence length 180
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRIS
SPILSKYDVAIVLNQPSLDKFEEKVKPGGILIYEGNGIINPPTRTDIEIYRIDAVEKAAE
LKNSKVFNMIVLGGLLGVCPVVSNNGLEKALYKTLPERHHGLIPLNMQAVDEGKKIIRKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]