dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E2RRQ1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E2RRQ1|E2RRQ1_CANLF) Solute carrier family 26 member 4 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SLC26A4 OC=Canis.
Sequence length 780
Sequence
MDAPRSRLEPPPLPEYSCSYVVSRPVFSELAFQQQHERRLQERKTLRESLARGCSCSRKR
GLGVLKTLLPILDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFHTSSGNGTAFNATVIDYAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLIEIFQNVGNTNLADFIAGLLTIIICMAVKEVNDRFKHKIPVPI
PIEVIVTIIATAISYAANLEKNYNAGIVKSIPRGFLPPVLPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYAIKYDYAIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIASIILGLDLGLLAGLMFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTTNYKNIE
ELEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIIRDAGSSNDAFEPDEDTEDPEDPDVPTKEIEIRVDWNSELPVKMNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFASLQDHVIEKLEKCGFFNDNIRKDIFFL
TVHDAVLHLQNQVKSREVQDSILETITLIQDCKDPLELMEAELIEEELDVQDEAMRSLAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]