dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E4U9Y4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E4U9Y4|E4U9Y4_OCEP5) Lytic transglycosylase catalytic {ECO:0000313|EMBL:ADR37298.1} KW=Complete proteome; Reference proteome OX=670487 OS=506). GN=Ocepr_1846 OC=Oceanithermus.
Sequence length 550
Sequence
MFRRLATLGLLFLAPVWAQLPAPYRAYEQARQAEDAGGLERLLAEPGYVQVLAARALSRM
AALSPSRRLELAERAARFENAAGDWLWVGRLREVLGDAPGAAEAYGKALPEPEAEAALVR
LARAGVRRAYAALYAGRAYEALLDALPAEGEAAWRARALAGLHRYAEALPHFRAWARDSR
EGRLALGRLLLELKRYAEAEAAFRDAGGAAGAFGRGRALEALGRSEAAVRAYLEARTPEA
LWRATALLERAGRAAEALPLYRELATGDSQYADDATLRLWVLARRRGDAALEAWAYARLD
GGLGLLAGRPYPRPPSGGAPPVAAAGAERAEALFAAGREAWAWGEARWWARRYRQEGRSE
QLAAVVAELERWGWWGRALRLLHGLPLRDGGGDLLRLAYPRAYPGIVEAEARAFGLEPEL
LWAVMRVESRFDPEAVSPTGAKGLMQFVAATWSDVARRLGEEGADPFDPEAAVRFGAYYL
RHLLDVCDRELVCALAGYNGGPGYTRRALAAEDGDVWDFLRFQPRDEPREYVERVLWAYQ
AYKALYRAAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]