dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E6SPI2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E6SPI2|E6SPI2_BACT6) Regulatory protein SIR2 homolog {ECO:0000256|HAMAP-Rule:MF_01121} KW=Complete proteome; Reference proteome OX=693979 OS=36-108). GN=Bache_0854 OC=Bacteroides.
Sequence length 232
Sequence
MKNLVVLSGAGMSAESGISTFRDAGGLWDRYPVEQVATPEGYARDPELVINFYNERRRQL
LDVKPNAGHAGLAELERDFNVTVVTQNVDNLHERAGSTHVIHLHGELTKVCSSRDPYNPH
FIKELKPGEYEVKMGDKAGDGTQLRPFIVWFGEAVPQIETAIRYVEKADIFVIIGTSMNV
YPAAGLLNYVPREADVYLIDPKPVDAHTLRQIHVIRKGASDGVEELISLLRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]