dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E6SUH6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E6SUH6|E6SUH6_BACT6) Putative transmembrane protein {ECO:0000313|EMBL:ADV43340.1} KW=Complete proteome; Reference proteome OX=693979 OS=36-108). GN=Bache_1334 OC=Bacteroides.
Sequence length 372
Sequence
MGHQRVLSSKFNMSLGFIPVIISILLCEFMTQDISIYIGSGVGLLLYFCSRRHKGVYIPP
IILYSTTGMLLLLSITAFFTTSPCPSFLFPFTLEISATIPPIAIYLNRKRFLDYHTAQTG
QCCKQLFAQAAEAAIVSARVVLIISFLHLIIIFLTVLISYPLGNTTRYILFNIAPPAVFI
LCIIFNQFGIFYFNIVMRHTVFVPIVNTKGDVTGKAIASEAINKKNEFINPVIRIAVASH
GMLFLLPRPQCSVLEGGKTDLLIEGYLLYGETLEQGAGRILRQTLPTALTSDLYFNLMYH
FENEKTNRLNYLFTLDLDDDSVLCNKTFKGGKLWTLQQIEHNLGKEFFSHCFECEYEHLK
AIICTREKYRES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]