dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E6TZ57 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E6TZ57|E6TZ57_BACCJ) Uncharacterized protein {ECO:0000313|EMBL:ADU32500.1} KW=Complete proteome; Reference proteome OX=649639 OS=/ JCM 9156 / N-4). GN=Bcell_4273 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence length 155
Sequence
MHLEIKVIKDNNKNEYTHIKLPSPYLEEEINEIVGTDCYSIQFNKSIKNKVNLSIADINL
IAERLERYDTALVEAMYEYTGCLYETFVCLEEYRYQYKSGVSSLVEVAEEMVKLGYLGTN
DLSEEVLRYISFDKIARDLDAEGWKIINNIAILAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]