dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E8V1K3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E8V1K3|E8V1K3_TERSS) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_0363 OC=Terriglobus.
Sequence length 688
Sequence
MKILSSWLREFLPSLTVDDHHLAEDLTLRGIAVEGVHEVEGGHLFEMDITTNRVDAMNHY
GVAREAAAIYGIPLMKIEDDCHAATTGDGYPVRIEAEDLCGRFTAQVVRGVNVAASTGLM
AERFAQLGQKPISNVVDVTNYTWLAMGHPTHAFDLDTLEGAIVVRRAREGEKLHLLDGSE
KTLTAEDLVVADEKKALALAGVMGGWDSRVTESTKNVLVEAAWFDQAAIRASSKRHGLHT
DASHRFERGADFAAAPVANRYVVKKLVEWCGGTAEGGMTDIVVSAIEARTAKRPHIAMSA
EEVRRLLGTTLEGGLVSADDIEKYLEALGCGLRPAAIVGTYEVALPSWRLDLEREIDLIE
EVARVYGYNRFADTLPAFSGGIIALPHVEQERVLRETLRGLGWSEVIGSTFCSEADAATF
AGEKGVVAMGNPLNAEAGVLRPSLLPGAVTMLAGNLNRDVREARVFEIGAVFTGSTAEVH
EEPSLALAAYGGARATQTISERDALFFEMKGAVEGLLAKFAPVGVSYEASPLPAWMEPGR
GARVLRGGEEIAVIGELSAAIAEKRKLKQVVVLGEVRAVKLLATPLRTPLAKEPSRFQAV
DRDLSFLFSDAVRWGAIESAIRGVGAAELVSVEPLEIFRGKTVAEGEYSLLLRIVLQAAD
RTLREDEVTGIVERVTQALASLGGKQRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]