dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F0UNS3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F0UNS3|F0UNS3_AJEC8) Uncharacterized protein {ECO:0000313|EMBL:EGC46835.1} KW=Complete proteome; Reference proteome OX=544711 OS=(Histoplasma capsulatum). GN=HCEG_06050 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence length 134
Sequence
MKSFLILLTAVYFIIVPHTLARRRVENINLVHNSEKNSNGLISTSGDKNVNKYLSYQPRS
HDGFEVHKTHDHLLPSERIQQSAQVLNKLKRAAAGCMRYPCDNSIICFSKLCGGCVIASG
SKAGVCSERYHPPR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]