dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F1QV08 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F1QV08|F1QV08_DANRE) Regulator of G protein-signaling 12a {ECO:0000313|Ensembl:ENSDARP00000040533} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=rgs12a OC=Cyprinidae; Danio.
Sequence length 1371
Sequence
MRLLDRPISPAVRRVEMERGRAGYGFTIAGQAPCVLRGIIKGSPAHSVGLLPGDRVLRVN
DTDVSEASHDVVVKLIGTSSKSLCLLVTSGDRPPMACCSSDEELGCQNKSKRPWLNPGIK
DPFPGKLDGRDLKEPILQSVGSFDTVFEISDQGTMTPHQEKQKKQRPLSEPDVSYWLQQQ
QRSKGNVDILSQDETSRVVSEDSVFSDLQSQNDLASDSSILNVAMIVGYINSMELELVMS
QTEEDALQVIRQCISKIGIEQKTHSLVLMKVKCNCVQLCDDRDVVLASYPAENLALCVIC
TEDSRFFGLVSIDSTKNIDTGRQTSTLKTLCHVFFIDPELYEHKEHQSIIGHFGIPCTPD
PDTQSCLEFPQTPHSISHFISVLYADMGDYIEKLRLKLDSENPDEGSQNARNSGSGSGSD
SGIGNASPEERDSLIGQWSFTSPNICNPPPPYYSQHRNSTFLKPECRCLLSEPLTGSAQP
ATPSGVPAGADGSAFTPVPLSKQSNLPPKQRAGQRRPSIGLKARWQKSRPNSIECLVEGD
NDDPKSKCSTLPPAMEQIPTLRYKPLEHTQRINFTPQLELTSRFFSSAAKQKDGENKGSL
FWALTRGRSSVRRPSGPAKRLSLAHSLNDLESAASDGERSGGGVQRHDCSSVSSLDSNGS
LPSVTNHCRFTERRVALWAVSFERLLQDPVGVRYFSEFLKKEFSEENILFWQACECFSQV
PEHDKKQLSQKAKEIYNRFLSSKATMPVNIDSQAQLADDVLTAPQPNMFKQPQLQIFNLM
KMDSYARFLKSTLYQECMLAEVEGRPLPDPCPIPCSPAPSKHSFTSDRSTFSTPKKENRK
PKTGRSSDDLREKHSDKKNGFFSWYRYPSIGKGQKKREAPDLPYHCNGRRESQGSLSSGA
SQELNTSCSGGKNEQCELRGSSCALDKERERCSRTCTVTLPDGSSCSIPLRQGASIRQVL
LELCQKQHINLAAVDLFLTGGEKPLVLDQDSITLSSRELRLEKRTLFRLDLVPINRSVGL
KAKPTKPVTEVLRPVVAKYGLQLGDLVARISGETEVLDLGVPISNLDGLRVVLERADPAK
AEKSKTLNSKTPAAKKGFPRERDDNSTVKPLKADVEDKHPRTAASERKKGKKNHIDETEE
FFELLSRAQSSRVDDQRGLLRKEDLVLPDFLRVNPDPKPQSPPSCSTPTSHKPGHTTTTS
TNPHPPKPSPCNGHQASAPFSAPLSPILRSAGAREQEEEEGLGDLTLVAEGDISSPNSTL
LPPPPPVSPPPYDGSLAEANFTPPPAVHGTGTEEENTSTSAVNSSTAQPDLRVRDKGVTL
EDSFEGYAAELRQCQNKMRNGVYPSTEAPRPLSGVLEVNESDTVQYKATFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]