dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F2L5X3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F2L5X3|F2L5X3_THEU7) Peptidase C14, caspase catalytic subunit p20 {ECO:0000313|EMBL:AEA12418.1} KW=Complete proteome OX=999630 OS=Thermoproteus uzoniensis (strain 768-20). GN=TUZN_0935 OC=Thermoproteaceae; Thermoproteus.
Sequence length 800
Sequence
MRAGLVALVVLLLISLVVNAQQITTLGIRVSMPAPLPSQQFPAAIVDFTGMVRHELYLND
MFYITFDLTQYQGTYFVVIKQIGGPGSPAEVAYGDVQGGYIYGYPMEIVQPIYEGQTYTF
EIDLYNQNGAFVGSATVSYVEKWCPDVTIDGVQLTPSTPVGGGNVQVAVTLTNDGEESWR
YHVSVYSQGGALTKTSQDVTIGAGSTTTVTLTVPVSATYTATTDTMVVDVSCDNGAWHFT
RSYQINIMPARPGPFVISAPTVQARLGQPVTFTLSLTNQGSDAQPISLTFSTGSASFNLP
STLPGGTTTNVPVTFTPTMPGVYKVTVTLTYKSPITGQTYQDTGSFTVEVYAELAVNAVD
QNGNPVQITPNIAGNNTSVAWLLPGTYTVSVPQIVDLGGGARLVFVGWQGGGTSPSTTVT
LNGNTQLTAVYKEQYQVVLDLSPALSSQTYWVDAGSSFTPQAPSHVDITQDSRWALEGFQ
VAGQQIGPGQAITVTGPLTIKAVWVKEYKITVSCGQVACINGQSQYVQWAQEGSTLSITL
AQIVNVNSRTRWVLSGSPTISFTVTGPQTITPNYVEEYYVNFGYAVKTASGISSTTVVTG
AWIESGNTVTIPTNQLEPPGGPGVKYVFSGYLVGNTPISGPQSGQTITVTGPVDVYAVWD
KYYYLNVTTPVGTAQGGGWYLADSYATVSVGQTTYGFLVYQRFVKWVASDGSVYTDPTIT
IKVDKPLTLTAVWAQDFTQAAILGGGLAAAGTAFWKRDFITRTLSRTFMKTRSKTRVELE
DVDKTHTWVAGEKKESNDNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]