dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4B5C7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4B5C7|F4B5C7_ACIHW) Glutamine amidotransferase class-II {ECO:0000313|EMBL:AEE93221.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0330 OC=Acidianus.
Sequence length 585
Sequence
MGGIFGFICNSPKDVNVAINGLKRLVYRGYDSAGIVYMNGKLTVKKIVGNITKVDLQISG
TSRIVLAHTRYASRGWPTLENAHPLFDCNKKIALVMDGVIDDYEEIRDKLIKQGHKFVST
TDTEVLPHLLENSQDYIRSSIEIIKNIKGIYSFAFIVDGINKIFAGSAGQPIVIGITQEC
KYVSSDLPSLNGFAENAIILPENSVAEISEDYVKIFDIQGNQITVQPKRVKYQEEIVDKG
GYPHFMLKEIYDIPSALISSFTSLMEKYLSLSAMIVYGAKNVYVIGNGTSLHAGLISSYY
FAEVGINVNVVSAAEFPYYALENIGTGSVIIAISQSGETADVIRSVKMAKQRGAVIVGIT
NSVGSRLALESNVYLPITAGPELAVPATKTFTSTLVVLRTLSLYTGLNSGKKSKSDIEKL
KEDLNNLSKALSSNLPQIEKQAEDAVAKINSESMYVTSSGINFPVAMEGALKFKEASLTH
AEGIQLGELLHGPIALTNKGYPIVVIKPAEEQAYDLYNKVVKSISDRGSPIILISNDGML
KSVETTRELSPIANVVPLQLMAYKLGVKKSLPIDTPPGLVKAVVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]