dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4D1X2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4D1X2|F4D1X2_PSEUX) GntR domain protein {ECO:0000313|EMBL:AEA28032.1} KW=Complete proteome; Reference proteome OX=675635 OS=13855 / CB1190). GN=Psed_5909 OC=Pseudonocardia.
Sequence length 239
Sequence
MSVQDSEFVFEPIGAGRGFEKIVTSLRGAIVRGELVAGQRLPSEPELAGQLGVSRPMLRE
ALKALEVSGYLEVRRGYGGGRFVAMPEPEEFHAITAAPLSTMDVEPRHVMDVRLAVEPMA
ARLSAQDGDTADLERALRMLGMAGTRPARAVAAVASFHVALVEASQNPVFVAVFESLRGP
VAMSLGQRVRERDWPGRARDGLAHVVRLIEDGEGGAAERAMRKYLLDFEDDRDQREEDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]