dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4GPG2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4GPG2|F4GPG2_PUSST) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1007105 OS=Pusillimonas sp. (strain T7-7). GN=PT7_0754 OC=Alcaligenaceae; Pusillimonas.
Sequence length 351
Sequence
MKKIRVLCVDDSALVRGLMTEIINSQPDMEVVASAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLERLMRLRPMPVVMVSSLTERNSEVTLRALELGAVDFVTKPKLGLRDGLMEYS
LLIADKIRAAAHSRPRYAAPPATTAPRKQLTHVFSGTEKLVMIGASTGGTEAIRQVLEPL
PANSPAIMITQHMPAGFTKSFVQRLDSLCAVQVHEAEDGQRVLPGHVYLAPGGIAHMKLA
RSGANYVVKLEYSDPVNRHRPSVDVLFHSAAQVAGRNAVGAILTGMGKDGAQGMLAMRQA
GAQTFAQDEASCVVFGMPREALHIGATDVAVPLSEMSARILASAGSYGHRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]