dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4K1Z8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4K1Z8|F4K1Z8_ARATH) Uncharacterized protein {ECO:0000313|EMBL:AED97421.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At5g61100 OC=Arabidopsis.
Sequence length 227
Sequence
MVYESGNKPGPENPTFSSDLSLSDSLVKLKKKPCEVCGSDANELLMMTCFMCRDTREHTY
CARVMFQRVPRLWICEECRDFSSVANKTANAQSSRTIQVEQVVVKQVRIDQTVPSPRTNQ
VVDNHQDPPIDQTDPSSTTIQVVDNENLIEAAPSSRSNQVVDNKDWIEAAPSLRSNQVVP
VAPRIHEFTTDESSSPVSPLFKSMWERFPVKRPSHYIDLSSDSESEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]