dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4K4G6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4K4G6|F4K4G6_ARATH) RING/FYVE/PHD zinc finger superfamily protein {ECO:0000313|EMBL:AED94096.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F24C7.4 OC=Arabidopsis.
Sequence length 1193
Sequence
MLETNEQKGFDLNVCASIEDFSESDIKAEGETDSLVDGNVENVIEIKDKKKVIEREILIT
RRVLRSGSVARDLVNSDKHCKAVKRKGNVVSGGSSVDEVKEEVKQECVKSLVPEEIRGDD
FRSEVKVESKDDRSDDGKEEKVQRKRGRPRKFGMSSQSDDNGLISNCKLRTSLGKKKELV
GDDNVEKLVGGSCFNKEKAEVKLEHGEYAEDKEILGLDFRSQVKVEIKDDECGIVELHDE
ELQVKRKRGRPRKVQISSQSDESRPNTNCKLARTPELSSQSSVDRISLSRLRGRPPKTKE
TSVSLYIEKGPESNGRRMVRKRGRPPTPQKKRKSGMTDESDWKAKKRLKLCESPLESRHN
NPLIDDERMIGEQRSKQTEAGGHSRSKSKKMLSDRILQLLLTAGWTVEYRPRNGRAYQDA
VYLNPEGKTHWSVTKAYQVYKKQLESNPNDQKNSTTGSGFGLLPEEDLHLLERTIQKKRS
DTGKQRSKLKDRDTNDILVSTKGTGKIKREEKHSRKRCTPSARSSLKDVDSKEDGYILFE
GKRTMLGWMIDSTIVPLNGKVQCMDCKKTDILLEGIITKEGIRCNCCDEVFSVLDFEVHA
GGNRNQPFKSLYLEGGNSLLQCLHESMNKQSESQLKGYHFVDFGSGDPNDDTCGICGDGG
DLICCDGCPSTFHQSCLDIKKFPSGAWYCYNCSCKFCEKDEAAKHETSTLPSLSSCRLCE
EKCSKHYPHTLADHQACINQDGTVPGERSTDSFCGKYCQELFEELQLFIGVKHPLPEGFS
WSFLRRFELPSEVADCDISEKIAYNAKMAVAFSVMDECFSPLVDHRSGVNLLQNIVYNFG
SNFHRLDFSSFLTAVLERGDEIIAVASIRIHGNQLAEMPFIGTRYMYRRQGMCRRLMDGI
ESFVAYFSQMFLAISEVLLDVWQFCCYPACFGDGPFCFFSGFGFAPVNDSEKKTIKNLNL
LVFPGVDMLGKSLVKEKITDSVVSSPNGLVLLAPEMTLPVDVEENKPEESKDSAHERNCA
TAGVESPSNPVDSCLKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVD
DSHADQSDTKEQEIDDKEDKTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGE
ELGNRTLALKREVTPTLRASPRLIQRSWRTSRVNQKFTGTTNAVLLDSPHRCV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]