dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4P5P4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4P5P4|F4P5P4_BATDJ) Uncharacterized protein {ECO:0000313|EMBL:EGF79220.1} KW=Complete proteome; Reference proteome OX=684364 OS=chytrid fungus). GN=BATDEDRAFT_89535 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence length 280
Sequence
MTATDAEKLEIVSGFIKDSPPGEINDVFNDVRSLVADDSLLQNTIESTFADHHAKQLVSV
QVPSKDYEVILGEYGCIEPSKYVDPRSGQALIVDLVHQTVKSVEPYHSKCSAHLLDQRAA
LDVAVQEYTASFYPSSVCTVWATEDEALVIAIVANKYHPDSFWSGRWRSLWRLEPKSSML
TGSAKVQVHYYEDGNVQHNSTQDYSVSITASDQEPSTLAATVIKHISKLEAEYQTTLNDQ
HNRLALETFKSLRRALPISRTKIEWQGILSYKIGSELVSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]